PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s65509539g002
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family bZIP
Protein Properties Length: 308aa    MW: 33780.9 Da    PI: 9.7224
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s65509539g002genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1361.5e-11161219563
                          CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                          kr +r   NR +A rs +RK ++i+eLe+kv++L++e ++L  +l  l+  +a l+s++
  PDK_30s65509539g002 161 KRVKRILANRQSAARSKERKMKYIAELERKVQTLQTEATTLSAQLTLLQRDSAGLTSQN 219
                          899**************************************************999998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.4E-19157221IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.967159222IPR004827Basic-leucine zipper domain
PfamPF001702.4E-10161219IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.6E-12161218No hitNo description
SuperFamilySSF579592.53E-11161212No hitNo description
CDDcd147036.95E-23162213No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MNLESLDTLN SSEEKRGDLD SRASGTKTNG ADSSENEAES CVNEGGGSGV KLWPNHSPLV  60
QKREGAKRSA AGNPGPIGTT TRHCRSLSMD SCMGRLNFGE VSPKKPPSPG FLAAQTPQAN  120
SKDGASNMFS LEFGNGEFSP AEMKKIMANE KLLEMASTDP KRVKRILANR QSAARSKERK  180
MKYIAELERK VQTLQTEATT LSAQLTLLQR DSAGLTSQNN ELKFRLQAME QQAQLRDALN  240
EALTAEVQRL KLATGELVNG RASNSLNQQI PINPQMFQQQ QQQPAQLPLY QLQQQQQNNA  300
GMHQEAKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008803311.10.0PREDICTED: transcription factor RF2a-like
TrEMBLA0A067DUN51e-125A0A067DUN5_CITSI; Uncharacterized protein
STRINGVIT_03s0038g00860.t011e-124(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.37e-86bZIP family protein